PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462863704
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family VOZ
Protein Properties Length: 589aa    MW: 64936.6 Da    PI: 5.3931
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462863704genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ424.51.6e-1302905071217
        VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfdls 99 
                p+p+afl+pkcalwdc+rpa gse++qdycs +ha+la++e g+pgt+pv+rp+gidlkdg+lfaalsak+qgk+vgip cegaat+kspwna+elfdl 
  462863704 290 PAPAAFLRPKCALWDCPRPAMGSERWQDYCSIYHADLAVKEeGPPGTMPVIRPRGIDLKDGPLFAALSAKIQGKHVGIPICEGAATSKSPWNAPELFDLY 389
                89*************************************9879********************************************************* PP

        VOZ 100 llegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksakgk 199
                ++ege+irewlffdkprraf+sgnrkqrslpdy grgwhesrkqvmk+fgglkrsyymdpqpsss+ewhlyeyein++da+alyrle+k++d+kksak+k
  462863704 390 IFEGESIREWLFFDKPRRAFDSGNRKQRSLPDYGGRGWHESRKQVMKDFGGLKRSYYMDPQPSSSYEWHLYEYEINDCDAFALYRLEFKSSDAKKSAKSK 489
                **************************************************************************************************** PP

        VOZ 200 vskdsladlqkklgrlta 217
                +++++l+++q++++rl+a
  462863704 490 LACNPLNEIQQQMVRLSA 507
                ****************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 589 aa     Download sequence    Send to blast
PENSLEHLAP ATQDGSERKK KKRLHDPIHS SPRQLISGGG GDGEGAFVAG GVAAPSVPRA  60
RQDPRRRPPG DVLRPPVRAQ GLPMLREWRA ELSAPSPASS LQQGNNGELS DPPSETLRLL  120
HLAAAKEEED DATSKLVDQQ QQPPPPPPAP VNQGPGHVQS GQDMKLEPAE EAVTVAVAPQ  180
QPPQGQVILG NGGGIPAPTA AAAVFHDQMY YVNQELTVED FLYDDDYKLN LTGSNPDVLN  240
NLEGIGQLEY PQFNFPQELP PNMYLDMSNC GQSAGDTFLH MSDLLTTMTP APAAFLRPKC  300
ALWDCPRPAM GSERWQDYCS IYHADLAVKE EGPPGTMPVI RPRGIDLKDG PLFAALSAKI  360
QGKHVGIPIC EGAATSKSPW NAPELFDLYI FEGESIREWL FFDKPRRAFD SGNRKQRSLP  420
DYGGRGWHES RKQVMKDFGG LKRSYYMDPQ PSSSYEWHLY EYEINDCDAF ALYRLEFKSS  480
DAKKSAKSKL ACNPLNEIQQ QMVRLSADSP VDTKRLSRSR IKANPKDVNA NIYSASNTTI  540
QANVPNAYQA VPQVDQMQFL NGDVVYGPHL PYGYSTERSD FYWNSNNGA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11623ERKKKKRL
21722RKKKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015688108.10.0PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ01e-134VOZ1_ARATH; Transcription factor VOZ1
TrEMBLK3XG450.0K3XG45_SETIT; Uncharacterized protein
STRINGSi000864m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-117vascular plant one zinc finger protein